Lineage for d1woja_ (1woj A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.61: LigT-like [55143] (1 superfamily)
    duplication of beta-alpha-beta-alpha-beta motif: antiparallel beta sheet forms barrel (n=6, S=8) similar to the barrel of prokaryotic DNA topoisomerases I and III
  4. Superfamily d.61.1: LigT-like [55144] (5 families) (S)
  5. Family d.61.1.3: 2',3'-cyclic nucleotide 3'-phosphodiesterase, catalytic domain [103043] (2 proteins)
    automatically mapped to Pfam PF05881
  6. Protein automated matches [190813] (2 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [188086] (1 PDB entry)
  8. Domain d1woja_: 1woj A: [161973]
    automated match to d2ilxa1
    complexed with po4

Details for d1woja_

PDB Entry: 1woj (more details), 1.8 Å

PDB Description: Crystal structure of human phosphodiesterase
PDB Compounds: (A:) 2',3'-cyclic-nucleotide 3'-phosphodiesterase

SCOPe Domain Sequences for d1woja_:

Sequence, based on SEQRES records: (download)

>d1woja_ d.61.1.3 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lplyfgwfltkkssetlrkagqvfleelgnhkafkkelrqfvpgdeprekmdlvtyfgkr
ppgvlhcttkfcdygkapgaeeyaqqdvlkksyskaftltisalfvtpkttgarvelseq
qlqlwpsdvdklsptdnlprgsrahitlgcaadveavqtgldlleilrqekggsrgeevg
elsrgklyslgngrwmltlaknmevraiftgyyg

Sequence, based on observed residues (ATOM records): (download)

>d1woja_ d.61.1.3 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lplyfgwfltkkssetlrkagqvfleelgnhkafkkelrqfvpekmdlvtyfgkrppgvl
hcttkfcdygkapgaeeyaqqdvlkksyskaftltisalfvtpkttgarvelseqqlqlw
psdvdklsptdnlprgsrahitlgcaadveavqtgldlleilrqekggsrgeevgelsrg
klyslgngrwmltlaknmevraiftgyyg

SCOPe Domain Coordinates for d1woja_ are not available.

Timeline for d1woja_: