Lineage for d1wlca_ (1wlc A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2779190Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)
  6. 2779456Protein automated matches [190029] (6 species)
    not a true protein
  7. 2779460Species Conger eel (Conger myriaster) [TaxId:7943] [188077] (3 PDB entries)
  8. 2779463Domain d1wlca_: 1wlc A: [161963]
    automated match to d1is3a_
    complexed with mes; mutant

Details for d1wlca_

PDB Entry: 1wlc (more details), 2 Å

PDB Description: congerin ii y16s/t88i double mutant
PDB Compounds: (A:) Congerin II

SCOPe Domain Sequences for d1wlca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wlca_ b.29.1.3 (A:) automated matches {Conger eel (Conger myriaster) [TaxId: 7943]}
draevrnipfklgmsltvggvvnsnatrfsinvgestdsiamhmdhrfsygadqnvlvln
slvhnvgwqqeerskkfpftkgdhfqititfdthtfyiqlsngetvefpnrnkdaafnli
ylagdarltfvrle

SCOPe Domain Coordinates for d1wlca_:

Click to download the PDB-style file with coordinates for d1wlca_.
(The format of our PDB-style files is described here.)

Timeline for d1wlca_: