![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins) |
![]() | Protein automated matches [190029] (6 species) not a true protein |
![]() | Species Conger eel (Conger myriaster) [TaxId:7943] [188077] (3 PDB entries) |
![]() | Domain d1wlca_: 1wlc A: [161963] automated match to d1is3a_ complexed with mes; mutant |
PDB Entry: 1wlc (more details), 2 Å
SCOPe Domain Sequences for d1wlca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wlca_ b.29.1.3 (A:) automated matches {Conger eel (Conger myriaster) [TaxId: 7943]} draevrnipfklgmsltvggvvnsnatrfsinvgestdsiamhmdhrfsygadqnvlvln slvhnvgwqqeerskkfpftkgdhfqititfdthtfyiqlsngetvefpnrnkdaafnli ylagdarltfvrle
Timeline for d1wlca_: