SCOPe 2.08: Domain d1wl2a_: 1wl2 A:

Lineage for d1wl2a_ (1wl2 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.128: Terpenoid synthases [48575] (1 superfamily)
   multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers

4. Superfamily a.128.1: Terpenoid synthases [48576] (6 families)
   duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J

5. Family a.128.1.1: Isoprenyl diphosphate synthases [48577] (4 proteins)

6. Protein automated matches [190489] (5 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:243274] [188078] (1 PDB entry)

8. Domain d1wl2a_: 1wl2 A: [161962]
   automated match to d1v4ea_
   complexed with so4; mutant

Details for d1wl2a_

PDB Entry: 1wl2, 2.8 Å

PDB Description: crystal structure of octaprenyl pyrophosphate synthase from hyperthermophilic thermotoga maritima r90a mutant

PDB Compounds: (A:) octoprenyl-diphosphate synthase

SCOPe Domain Sequences for d1wl2a_:

Sequence; same for both SEQRES and ATOM records:

>d1wl2a_ a.128.1.1 (A:) automated matches {Thermotoga maritima [TaxId: 243274]}
nsyelekvkerieqilsqffpeqimkdlplygkmlrvrlsilsfknrgveigedaissla
alelvhlasllhddvidgarfargketinfmygdkaavaagdlvlvsafhtveeignnkl
rraflnvigkmseaelieqlsrykpitkeeylrivegksgalfglalqlpallegelged
lynlgvtigtiyqmfddimdfagmekigkdgfldlkngvasfplvtamekfpearqmfen
rdwsglmsfmrekgilkeceetlkvlvknviienswlrd

Timeline for d1wl2a_:

• d1wl2a_ first appeared in SCOPe 2.01
  
• d1wl2a_ appears in SCOPe 2.07