Lineage for d1wkxa_ (1wkx A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3029894Superfamily g.3.1: Plant lectins/antimicrobial peptides [57016] (3 families) (S)
  5. 3029895Family g.3.1.1: Hevein-like agglutinin (lectin) domain [57017] (7 proteins)
  6. 3030064Protein automated matches [190807] (2 species)
    not a true protein
  7. 3030065Species Rubber tree (Hevea brasiliensis) [TaxId:3981] [188076] (1 PDB entry)
  8. 3030066Domain d1wkxa_: 1wkx A: [161961]
    automated match to d1heva_

Details for d1wkxa_

PDB Entry: 1wkx (more details), 1.7 Å

PDB Description: Crystal Structure of a Hev b 6.02 Isoallergen
PDB Compounds: (A:) hevein isoform 2

SCOPe Domain Sequences for d1wkxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wkxa_ g.3.1.1 (A:) automated matches {Rubber tree (Hevea brasiliensis) [TaxId: 3981]}
eqcgrqaggklcpdnlccsqwgwcgstdeycspdhncqsnckd

SCOPe Domain Coordinates for d1wkxa_:

Click to download the PDB-style file with coordinates for d1wkxa_.
(The format of our PDB-style files is described here.)

Timeline for d1wkxa_: