Class g: Small proteins [56992] (100 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.1: Plant lectins/antimicrobial peptides [57016] (3 families) |
Family g.3.1.1: Hevein-like agglutinin (lectin) domain [57017] (7 proteins) |
Protein automated matches [190807] (2 species) not a true protein |
Species Rubber tree (Hevea brasiliensis) [TaxId:3981] [188076] (1 PDB entry) |
Domain d1wkxa_: 1wkx A: [161961] automated match to d1heva_ |
PDB Entry: 1wkx (more details), 1.7 Å
SCOPe Domain Sequences for d1wkxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wkxa_ g.3.1.1 (A:) automated matches {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} eqcgrqaggklcpdnlccsqwgwcgstdeycspdhncqsnckd
Timeline for d1wkxa_: