SCOPe 2.02: Domain d1wkpc_: 1wkp C:

Lineage for d1wkpc_ (1wkp C:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.17: PEBP-like [49776] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.17.1: PEBP-like [49777] (3 families)

5. Family b.17.1.0: automated matches [191496] (1 protein)
   not a true family

6. Protein automated matches [190806] (2 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [188075] (1 PDB entry)

8. Domain d1wkpc_: 1wkp C: [161959]
   automated match to d1qoub_
   complexed with so4

Details for d1wkpc_

PDB Entry: 1wkp, 2.6 Å

PDB Description: flowering locus t (ft) from arabidopsis thaliana

PDB Compounds: (C:) FLOWERING LOCUS T protein

SCOPe Domain Sequences for d1wkpc_:

Sequence; same for both SEQRES and ATOM records:

>d1wkpc_ b.17.1.0 (C:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
rdplivsrvvgdvldpfnrsitlkvtygqrevtnglnlrpsqvqnkprveiggedlrnfy
tlvmvdpdvpspsnphlreylhwlvtdipattgttfgneivsyenpsptagihrvvfilf
rqlgrqtvyapgwrqnfntrefaeiynlglpvaavfynsqre

Timeline for d1wkpc_:

• d1wkpc_ first appeared in SCOPe 2.01
  
• d1wkpc_ appears in SCOPe 2.03
  
• d1wkpc_ appears in the current release, SCOPe 2.08