Class b: All beta proteins [48724] (174 folds) |
Fold b.17: PEBP-like [49776] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds |
Superfamily b.17.1: PEBP-like [49777] (3 families) |
Family b.17.1.0: automated matches [191496] (1 protein) not a true family |
Protein automated matches [190806] (2 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [188075] (1 PDB entry) |
Domain d1wkpc_: 1wkp C: [161959] automated match to d1qoub_ complexed with so4 |
PDB Entry: 1wkp (more details), 2.6 Å
SCOPe Domain Sequences for d1wkpc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wkpc_ b.17.1.0 (C:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} rdplivsrvvgdvldpfnrsitlkvtygqrevtnglnlrpsqvqnkprveiggedlrnfy tlvmvdpdvpspsnphlreylhwlvtdipattgttfgneivsyenpsptagihrvvfilf rqlgrqtvyapgwrqnfntrefaeiynlglpvaavfynsqre
Timeline for d1wkpc_: