Lineage for d1wkpb_ (1wkp B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774037Fold b.17: PEBP-like [49776] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2774038Superfamily b.17.1: PEBP-like [49777] (3 families) (S)
  5. 2774083Family b.17.1.0: automated matches [191496] (1 protein)
    not a true family
  6. 2774084Protein automated matches [190806] (3 species)
    not a true protein
  7. 2774091Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [188075] (5 PDB entries)
  8. 2774097Domain d1wkpb_: 1wkp B: [161958]
    automated match to d1qoub_
    complexed with so4

Details for d1wkpb_

PDB Entry: 1wkp (more details), 2.6 Å

PDB Description: flowering locus t (ft) from arabidopsis thaliana
PDB Compounds: (B:) FLOWERING LOCUS T protein

SCOPe Domain Sequences for d1wkpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wkpb_ b.17.1.0 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
rdplivsrvvgdvldpfnrsitlkvtygqrevtnglnlrpsqvqnkprveiggedlrnfy
tlvmvdpdvpspsnphlreylhwlvtdipattgttfgneivsyenpsptagihrvvfilf
rqlgrqtvyapgwrqnfntrefaeiynlglpvaavfynsqre

SCOPe Domain Coordinates for d1wkpb_:

Click to download the PDB-style file with coordinates for d1wkpb_.
(The format of our PDB-style files is described here.)

Timeline for d1wkpb_: