![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.17: PEBP-like [49776] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds |
![]() | Superfamily b.17.1: PEBP-like [49777] (3 families) ![]() |
![]() | Family b.17.1.0: automated matches [191496] (1 protein) not a true family |
![]() | Protein automated matches [190806] (3 species) not a true protein |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [188075] (5 PDB entries) |
![]() | Domain d1wkpa_: 1wkp A: [161957] automated match to d1qoub_ complexed with so4 |
PDB Entry: 1wkp (more details), 2.6 Å
SCOPe Domain Sequences for d1wkpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wkpa_ b.17.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} rdplivsrvvgdvldpfnrsitlkvtygqrevtnglnlrpsqvqnkprveiggedlrnfy tlvmvdpdvpspsnphlreylhwlvtdipattgttfgneivsyenpsptagihrvvfilf rqlgrqtvyapgwrqnfntrefaeiynlglpvaavfynsqres
Timeline for d1wkpa_: