SCOPe 2.05: Domain d1wkob_: 1wko B:

Lineage for d1wkob_ (1wko B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.17: PEBP-like [49776] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.17.1: PEBP-like [49777] (3 families)

5. Family b.17.1.1: Phosphatidylethanolamine binding protein [49778] (4 proteins)

6. Protein automated matches [190720] (3 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [188074] (1 PDB entry)

8. Domain d1wkob_: 1wko B: [161956]
   automated match to d1qoub_

Details for d1wkob_

PDB Entry: 1wko, 1.8 Å

PDB Description: Terminal flower 1 (tfl1) from arabidopsis thaliana

PDB Compounds: (B:) TERMINAL FLOWER 1 protein

SCOPe Domain Sequences for d1wkob_:

Sequence; same for both SEQRES and ATOM records:

>d1wkob_ b.17.1.1 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
rvieplimgrvvgdvldfftpttkmnvsynkkqvsnghelfpssvsskprveihggdlrs
fftlvmidpdvpgpsdpflkehlhwivtnipgttdatfgkevvsyelprpsigihrfvfv
lfrqkqrrvifpnipsrdhfntrkfaveydlglpvaavffnaqre

Timeline for d1wkob_:

• d1wkob_ first appeared in SCOPe 2.01
  
• d1wkob_ appears in SCOPe 2.04
  
• d1wkob_ appears in SCOPe 2.06
  
• d1wkob_ appears in the current release, SCOPe 2.08