SCOPe 2.05: Domain d1wcwa_: 1wcw A:

Lineage for d1wcwa_ (1wcw A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.113: HemD-like [69617] (1 superfamily)
   duplication: consists of two similar 'swapped' domain with 3 layers (a/b/a) each; parallel beta-sheet of 5 strands, order 21345

4. Superfamily c.113.1: HemD-like [69618] (1 family)
   automatically mapped to Pfam PF02602

5. Family c.113.1.1: HemD-like [69619] (3 proteins)
   Pfam PF02602

6. Protein automated matches [190804] (2 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:274] [188071] (2 PDB entries)

8. Domain d1wcwa_: 1wcw A: [161949]
   automated match to d1wd7b_
   complexed with gol

Details for d1wcwa_

PDB Entry: 1wcw, 1.3 Å

PDB Description: Crystal Structure of Uroporphyrinogen III Synthase from an Extremely Thermophilic Bacterium Thermus thermophilus HB8 (Wild type, Native, Form-1 crystal)

PDB Compounds: (A:) Uroporphyrinogen III Synthase

SCOPe Domain Sequences for d1wcwa_:

Sequence; same for both SEQRES and ATOM records:

>d1wcwa_ c.113.1.1 (A:) automated matches {Thermus thermophilus [TaxId: 274]}
avrvayaglrrkeafkalaeklgftpllfpvqatekvpvpeyrdqvralaqgvdlflatt
gvgvrdlleagkalgldlegplakafrlargakaaralkeaglpphavgdgtsksllpll
pqgrgvaalqlygkplpllenalaergyrvlplmpyrhlpdpegilrleeallrgevdal
afvaaiqveflfegakdpkalrealntrvkalavgrvtadalrewgvkpfyvdeterlgs
llqgfkralqkeva

Timeline for d1wcwa_:

• d1wcwa_ first appeared in SCOPe 2.01
  
• d1wcwa_ appears in SCOPe 2.04
  
• d1wcwa_ is called d1wcwa1 in SCOPe 2.06
  
• d1wcwa_ appears in the current release, SCOPe 2.08, called d1wcwa1