SCOPe 2.05: Domain d1wcv1_: 1wcv 1:

Lineage for d1wcv1_ (1wcv 1:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (96 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:262724] [187453] (12 PDB entries)

8. Domain d1wcv1_: 1wcv 1: [161948]
   automated match to d1hyqa_
   complexed with cl, iod

Details for d1wcv1_

PDB Entry: 1wcv, 1.6 Å

PDB Description: structure of the bacterial chromosome segregation protein soj

PDB Compounds: (1:) segregation protein

SCOPe Domain Sequences for d1wcv1_:

Sequence; same for both SEQRES and ATOM records:

>d1wcv1_ c.37.1.0 (1:) automated matches {Thermus thermophilus [TaxId: 262724]}
kvrrialanqkggvgktttainlaaylarlgkrvllvdldpqgnatsglgvraergvyhl
lqgepleglvhpvdgfhllpatpdlvgatvelagaptalrealrdegydlvlldappsls
pltlnalaaaegvvvpvqaeyyalegvagllatleevraglnprlrllgilvtmydgrtl
laqqveaqlrahfgekvfwtviprnvrlaeapsfgktiaqhaptspgahayrrlaeevma
rvqe

Timeline for d1wcv1_:

• d1wcv1_ first appeared in SCOPe 2.01
  
• d1wcv1_ appears in SCOPe 2.04
  
• d1wcv1_ appears in SCOPe 2.06
  
• d1wcv1_ appears in the current release, SCOPe 2.08