Lineage for d1wcua1 (1wcu A:2-145)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774971Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2774972Protein automated matches [190770] (51 species)
    not a true protein
  7. 2775372Species Piromyces equi [TaxId:99929] [188072] (1 PDB entry)
  8. 2775373Domain d1wcua1: 1wcu A:2-145 [161947]
    Other proteins in same PDB: d1wcua2
    automated match to d1oh3a_
    complexed with gol

Details for d1wcua1

PDB Entry: 1wcu (more details), 1.5 Å

PDB Description: cbm29_1, a family 29 carbohydrate binding module from piromyces equi
PDB Compounds: (A:) non-catalytic protein 1

SCOPe Domain Sequences for d1wcua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wcua1 b.18.1.0 (A:2-145) automated matches {Piromyces equi [TaxId: 99929]}
vsatysvvyetgkklnsgfdnwgwdskmsfkdnslvltadpdeygaislknlnsnyygkg
gciylqvkteteglvkvqgvrgydeteafnvgsfrsssdfteykfevddeyqfdriivqd
gpasnipiymryiiystgscddhi

SCOPe Domain Coordinates for d1wcua1:

Click to download the PDB-style file with coordinates for d1wcua1.
(The format of our PDB-style files is described here.)

Timeline for d1wcua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wcua2