SCOPe 2.08: Domain d1wcua1: 1wcu A:2-145

Lineage for d1wcua1 (1wcu A:2-145)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.0: automated matches [191481] (1 protein)
   not a true family

6. Protein automated matches [190770] (51 species)
   not a true protein

7. Species Piromyces equi [TaxId:99929] [188072] (1 PDB entry)

8. Domain d1wcua1: 1wcu A:2-145 [161947]
   Other proteins in same PDB: d1wcua2
   automated match to d1oh3a_
   complexed with gol

Details for d1wcua1

PDB Entry: 1wcu, 1.5 Å

PDB Description: cbm29_1, a family 29 carbohydrate binding module from piromyces equi

PDB Compounds: (A:) non-catalytic protein 1

SCOPe Domain Sequences for d1wcua1:

Sequence; same for both SEQRES and ATOM records:

>d1wcua1 b.18.1.0 (A:2-145) automated matches {Piromyces equi [TaxId: 99929]}
vsatysvvyetgkklnsgfdnwgwdskmsfkdnslvltadpdeygaislknlnsnyygkg
gciylqvkteteglvkvqgvrgydeteafnvgsfrsssdfteykfevddeyqfdriivqd
gpasnipiymryiiystgscddhi

Timeline for d1wcua1:

• d1wcua1 first appeared in SCOPe 2.01, called d1wcua_
  
• d1wcua1 appears in SCOPe 2.07