Lineage for d1wbic_ (1wbi C:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2415300Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2415301Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2415302Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 2415640Protein automated matches [190191] (2 species)
    not a true protein
  7. 2415641Species Chicken (Gallus gallus) [TaxId:9031] [186931] (28 PDB entries)
  8. 2415656Domain d1wbic_: 1wbi C: [161941]
    automated match to d1rava_
    complexed with btn, gol, so4

Details for d1wbic_

PDB Entry: 1wbi (more details), 1.4 Å

PDB Description: avr2
PDB Compounds: (C:) avidin-related protein 2

SCOPe Domain Sequences for d1wbic_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wbic_ b.61.1.1 (C:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
arkcsltgewdndlgsimtigavndngefdgtyitavadnpgnitlspllgiqhkrasqp
tfgftvhwnfsestsvfvgqcfvdrsgkevlktkwlqrlavddisddwiatrvgnndftr
q

SCOPe Domain Coordinates for d1wbic_:

Click to download the PDB-style file with coordinates for d1wbic_.
(The format of our PDB-style files is described here.)

Timeline for d1wbic_: