Lineage for d1wbib_ (1wbi B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1552675Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 1552676Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 1552677Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 1552986Protein automated matches [190191] (2 species)
    not a true protein
  7. 1552987Species Chicken (Gallus gallus) [TaxId:9031] [186931] (24 PDB entries)
  8. 1553001Domain d1wbib_: 1wbi B: [161940]
    automated match to d1rava_
    complexed with btn, gol, so4

Details for d1wbib_

PDB Entry: 1wbi (more details), 1.4 Å

PDB Description: avr2
PDB Compounds: (B:) avidin-related protein 2

SCOPe Domain Sequences for d1wbib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wbib_ b.61.1.1 (B:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
rkcsltgewdndlgsimtigavndngefdgtyitavadnpgnitlspllgiqhkrasqpt
fgftvhwnfsestsvfvgqcfvdrsgkevlktkwlqrlavddisddwiatrvgnndftrq

SCOPe Domain Coordinates for d1wbib_:

Click to download the PDB-style file with coordinates for d1wbib_.
(The format of our PDB-style files is described here.)

Timeline for d1wbib_: