SCOP 1.55: Domain d1dpra1: 1dpr A:3-64

Lineage for d1dpra1 (1dpr A:3-64)

1. Root: SCOP 1.55

2. Class a: All alpha proteins [46456] (138 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (26 families)

5. Family a.4.5.24: Iron-dependent represor protein [46882] (2 proteins)

6. Protein Diphtheria toxin repressor (DtxR) [46883] (1 species)

7. Species Corynebacterium diphtheriae [TaxId:1717] [46884] (10 PDB entries)

8. Domain d1dpra1: 1dpr A:3-64 [16194]
   Other proteins in same PDB: d1dpra2, d1dprb2

Details for d1dpra1

PDB Entry: 1dpr, 3 Å

PDB Description: structures of the apo-and metal ion activated forms of the diphtheria tox repressor from corynebacterium diphtheriae

SCOP Domain Sequences for d1dpra1:

Sequence; same for both SEQRES and ATOM records:

>d1dpra1 a.4.5.24 (A:3-64) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae}
dlvdttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdrsl
qm

Timeline for d1dpra1:

• d1dpra1 appears in SCOP 1.57
  
• d1dpra1 appears in the current release, SCOPe 2.08