SCOPe 2.03: Domain d1wara_: 1war A:

Lineage for d1wara_ (1war A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families)
   different families of this superfamily are groupped in a single Pfam family, Pfam PF00149

5. Family d.159.1.1: Purple acid phosphatase-like [56301] (3 proteins)

6. Protein automated matches [190524] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187482] (2 PDB entries)

8. Domain d1wara_: 1war A: [161937]
   automated match to d1qhwa_
   complexed with fe, nag, po4

Details for d1wara_

PDB Entry: 1war, 2.22 Å

PDB Description: recombinant human purple acid phosphatase expressed in pichia pastoris

PDB Compounds: (A:) human purple acid phosphatase

SCOPe Domain Sequences for d1wara_:

Sequence; same for both SEQRES and ATOM records:

>d1wara_ d.159.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eaeaefatpalrfvavgdwggvpnapfhtaremanakeiartvqilgadfilslgdnfyf
tgvqdindkrfqetfedvfsdrslrkvpwyvlagnhdhlgnvsaqiayskiskrwnfpsp
fyrlhfkipqtnvsvaifmldtvtlcgnsddflsqqperprdvklartqlswlkkqlaaa
redyvlvaghypvwsiaehgpthclvkqlrpllatygvtaylcghdhnlqylqdengvgy
vlsgagnfmdpskrhqrkvpngylrfhygtedslggfayveisskemtvtyieasgkslf
ktrlprrarp

Timeline for d1wara_:

• d1wara_ first appeared in SCOPe 2.01
  
• d1wara_ appears in SCOPe 2.02
  
• d1wara_ appears in SCOPe 2.04
  
• d1wara_ appears in the current release, SCOPe 2.08, called d1wara1