SCOPe 2.08: Domain d1wara1: 1war A:1-304

Lineage for d1wara1 (1war A:1-304)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families)
   different families of this superfamily are groupped in a single Pfam family, Pfam PF00149

5. Family d.159.1.1: Purple acid phosphatase-like [56301] (3 proteins)

6. Protein automated matches [190524] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187482] (2 PDB entries)

8. Domain d1wara1: 1war A:1-304 [161937]
   Other proteins in same PDB: d1wara2
   automated match to d1qhwa_
   complexed with fe, nag, po4

Details for d1wara1

PDB Entry: 1war, 2.22 Å

PDB Description: recombinant human purple acid phosphatase expressed in pichia pastoris

PDB Compounds: (A:) human purple acid phosphatase

SCOPe Domain Sequences for d1wara1:

Sequence; same for both SEQRES and ATOM records:

>d1wara1 d.159.1.1 (A:1-304) automated matches {Human (Homo sapiens) [TaxId: 9606]}
atpalrfvavgdwggvpnapfhtaremanakeiartvqilgadfilslgdnfyftgvqdi
ndkrfqetfedvfsdrslrkvpwyvlagnhdhlgnvsaqiayskiskrwnfpspfyrlhf
kipqtnvsvaifmldtvtlcgnsddflsqqperprdvklartqlswlkkqlaaaredyvl
vaghypvwsiaehgpthclvkqlrpllatygvtaylcghdhnlqylqdengvgyvlsgag
nfmdpskrhqrkvpngylrfhygtedslggfayveisskemtvtyieasgkslfktrlpr
rarp

Timeline for d1wara1:

• d1wara1 first appeared in SCOPe 2.01, called d1wara_
  
• d1wara1 appears in SCOPe 2.07