Lineage for d1wara1 (1war A:1-304)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. Family d.159.1.1: Purple acid phosphatase-like [56301] (3 proteins)
  6. Protein automated matches [190524] (2 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187482] (2 PDB entries)
  8. Domain d1wara1: 1war A:1-304 [161937]
    Other proteins in same PDB: d1wara2
    automated match to d1qhwa_
    complexed with fe, nag, po4

Details for d1wara1

PDB Entry: 1war (more details), 2.22 Å

PDB Description: recombinant human purple acid phosphatase expressed in pichia pastoris
PDB Compounds: (A:) human purple acid phosphatase

SCOPe Domain Sequences for d1wara1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wara1 d.159.1.1 (A:1-304) automated matches {Human (Homo sapiens) [TaxId: 9606]}
atpalrfvavgdwggvpnapfhtaremanakeiartvqilgadfilslgdnfyftgvqdi
ndkrfqetfedvfsdrslrkvpwyvlagnhdhlgnvsaqiayskiskrwnfpspfyrlhf
kipqtnvsvaifmldtvtlcgnsddflsqqperprdvklartqlswlkkqlaaaredyvl
vaghypvwsiaehgpthclvkqlrpllatygvtaylcghdhnlqylqdengvgyvlsgag
nfmdpskrhqrkvpngylrfhygtedslggfayveisskemtvtyieasgkslfktrlpr
rarp

SCOPe Domain Coordinates for d1wara1 are not available.

Timeline for d1wara1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wara2