SCOPe 2.06: Domain d1waqa_: 1waq A:

Lineage for d1waqa_ (1waq A:)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulfide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families)

5. Family g.17.1.0: automated matches [191392] (1 protein)
   not a true family

6. Protein automated matches [190506] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187459] (23 PDB entries)

8. Domain d1waqa_: 1waq A: [161936]
   automated match to d3bmpa_
   complexed with mpd

Details for d1waqa_

PDB Entry: 1waq, 2.28 Å

PDB Description: crystal structure of human growth and differentiation factor 5 (gdf-5)

PDB Compounds: (A:) Growth/differentiation factor 5

SCOPe Domain Sequences for d1waqa_:

Sequence; same for both SEQRES and ATOM records:

>d1waqa_ g.17.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
arcsrkalhvnfkdmgwddwiiapleyeafhceglcefplrshleptnhaviqtlmnsmd
pestpptccvptrlspisilfidsannvvykqyedmvvescgcr

Timeline for d1waqa_:

• d1waqa_ first appeared in SCOPe 2.01
  
• d1waqa_ appears in SCOPe 2.05
  
• d1waqa_ appears in SCOPe 2.07
  
• d1waqa_ appears in the current release, SCOPe 2.08