Lineage for d1waaf_ (1waa F:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2753554Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2753968Protein automated matches [190803] (3 species)
    not a true protein
  7. 2753969Species Human (Homo sapiens) [TaxId:9606] [188070] (29 PDB entries)
  8. 2753982Domain d1waaf_: 1waa F: [161935]
    automated match to d1tita_
    complexed with zn

Details for d1waaf_

PDB Entry: 1waa (more details), 1.8 Å

PDB Description: ig27 protein domain
PDB Compounds: (F:) titin

SCOPe Domain Sequences for d1waaf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1waaf_ b.1.1.4 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gamalievekplygvevfvgetahfeielsepdvhgqwklkgqplaaspdceiiedgkkh
ililhncqlgmtgevsfqaaqtksaanlkvkel

SCOPe Domain Coordinates for d1waaf_:

Click to download the PDB-style file with coordinates for d1waaf_.
(The format of our PDB-style files is described here.)

Timeline for d1waaf_: