![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.4: I set domains [49159] (39 proteins) |
![]() | Protein automated matches [190803] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188070] (29 PDB entries) |
![]() | Domain d1waae_: 1waa E: [161934] automated match to d1tita_ complexed with zn |
PDB Entry: 1waa (more details), 1.8 Å
SCOPe Domain Sequences for d1waae_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1waae_ b.1.1.4 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gamalievekplygvevfvgetahfeielsepdvhgqwklkgqplaaspdceiieegkkh ililhncqlgmtgevsfqaantksaanlkvke
Timeline for d1waae_: