SCOPe 2.06: Domain d1waab_: 1waa B:

Lineage for d1waab_ (1waa B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein automated matches [190803] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188070] (30 PDB entries)

8. Domain d1waab_: 1waa B: [161931]
   automated match to d1tita_
   complexed with zn

Details for d1waab_

PDB Entry: 1waa, 1.8 Å

PDB Description: ig27 protein domain

PDB Compounds: (B:) titin

SCOPe Domain Sequences for d1waab_:

Sequence; same for both SEQRES and ATOM records:

>d1waab_ b.1.1.4 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lievekplygvevfvgetahfeielsepdvhgqwklkgqplaaspdceiiedgkkhilil
hncqlgmtgevsfqaantksaanlkvkel

Timeline for d1waab_:

• d1waab_ first appeared in SCOPe 2.01
  
• d1waab_ appears in SCOPe 2.05
  
• d1waab_ appears in SCOPe 2.07
  
• d1waab_ appears in the current release, SCOPe 2.08