Class b: All beta proteins [48724] (180 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.19: Family 29 carbohydrate binding module, CBM29 [89244] (2 proteins) |
Protein automated matches [190801] (1 species) not a true protein |
Species Piromyces equi [TaxId:99929] [188067] (6 PDB entries) |
Domain d1w9fb_: 1w9f B: [161928] automated match to d1gwma_ mutant |
PDB Entry: 1w9f (more details), 2.25 Å
SCOPe Domain Sequences for d1w9fb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w9fb_ b.18.1.19 (B:) automated matches {Piromyces equi [TaxId: 99929]} atytvifknasglpngydnwgwgctlsyyggamiinpqegkygavslkrnsgsfrggslr fdmknegkvkilvenseadekfevetispsdeyvtyildvdfdlpfdaidfqdapgngdr iwiknlvhstgsaddfvdpi
Timeline for d1w9fb_: