Class b: All beta proteins [48724] (174 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) |
Family b.18.1.19: Family 29 carbohydrate binding module, CBM29 [89244] (2 proteins) |
Protein automated matches [190801] (1 species) not a true protein |
Species Piromyces equi [TaxId:99929] [188067] (6 PDB entries) |
Domain d1w90b_: 1w90 B: [161926] automated match to d1gwma_ complexed with edo, na; mutant |
PDB Entry: 1w90 (more details), 1.6 Å
SCOPe Domain Sequences for d1w90b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w90b_ b.18.1.19 (B:) automated matches {Piromyces equi [TaxId: 99929]} ratytvifknasglpngydnwgwgctlsyyggamiinpqegkygavslkrnsgsfrggsl rfdmknegkvkilvenseadekfevetispsdeyvtyildvdfdlpfdriafqdapgngd riwiknlvhstgsaddfvdpin
Timeline for d1w90b_: