Lineage for d1w90b_ (1w90 B:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1116326Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 1116327Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) (S)
  5. 1116835Family b.18.1.19: Family 29 carbohydrate binding module, CBM29 [89244] (2 proteins)
  6. 1116844Protein automated matches [190801] (1 species)
    not a true protein
  7. 1116845Species Piromyces equi [TaxId:99929] [188067] (6 PDB entries)
  8. 1116849Domain d1w90b_: 1w90 B: [161926]
    automated match to d1gwma_
    complexed with edo, na; mutant

Details for d1w90b_

PDB Entry: 1w90 (more details), 1.6 Å

PDB Description: cbm29-2 mutant d114a: probing the mechanism of ligand recognition by family 29 carbohydrate binding modules
PDB Compounds: (B:) non-catalytic protein 1

SCOPe Domain Sequences for d1w90b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w90b_ b.18.1.19 (B:) automated matches {Piromyces equi [TaxId: 99929]}
ratytvifknasglpngydnwgwgctlsyyggamiinpqegkygavslkrnsgsfrggsl
rfdmknegkvkilvenseadekfevetispsdeyvtyildvdfdlpfdriafqdapgngd
riwiknlvhstgsaddfvdpin

SCOPe Domain Coordinates for d1w90b_:

Click to download the PDB-style file with coordinates for d1w90b_.
(The format of our PDB-style files is described here.)

Timeline for d1w90b_: