| Class b: All beta proteins [48724] (180 folds) |
| Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
| Family b.18.1.19: Family 29 carbohydrate binding module, CBM29 [89244] (2 proteins) |
| Protein automated matches [190801] (1 species) not a true protein |
| Species Piromyces equi [TaxId:99929] [188067] (6 PDB entries) |
| Domain d1w8wb_: 1w8w B: [161922] automated match to d1gwma_ mutant |
PDB Entry: 1w8w (more details), 2.1 Å
SCOPe Domain Sequences for d1w8wb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w8wb_ b.18.1.19 (B:) automated matches {Piromyces equi [TaxId: 99929]}
ratytvifknasglpngydnwgwgctlsyyggamiinpqegkagavslkrnsgsfrggsl
rfdmknegkvkilvenseadekfevetispsdeyvtyildvdfdlpfdridfqdapgngd
riwiknlvhstgsaddfvdp
Timeline for d1w8wb_: