SCOPe 2.08: Domain d1w8wa_: 1w8w A:

Lineage for d1w8wa_ (1w8w A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.19: Family 29 carbohydrate binding module, CBM29 [89244] (2 proteins)

6. Protein automated matches [190801] (1 species)
   not a true protein

7. Species Piromyces equi [TaxId:99929] [188067] (6 PDB entries)

8. Domain d1w8wa_: 1w8w A: [161921]
   automated match to d1gwma_
   mutant

Details for d1w8wa_

PDB Entry: 1w8w, 2.1 Å

PDB Description: cbm29-2 mutant y46a: probing the mechanism of ligand recognition by family 29 carbohydrate binding modules

PDB Compounds: (A:) non-catalytic protein 1

SCOPe Domain Sequences for d1w8wa_:

Sequence; same for both SEQRES and ATOM records:

>d1w8wa_ b.18.1.19 (A:) automated matches {Piromyces equi [TaxId: 99929]}
ratytvifknasglpngydnwgwgctlsyyggamiinpqegkagavslkrnsgsfrggsl
rfdmknegkvkilvenseadekfevetispsdeyvtyildvdfdlpfdridfqdapgngd
riwiknlvhstgsaddfvdpinlehh

Timeline for d1w8wa_:

• d1w8wa_ first appeared in SCOPe 2.01
  
• d1w8wa_ appears in SCOPe 2.07