SCOPe 2.01: Domain d1w8ua_: 1w8u A:

Lineage for d1w8ua_ (1w8u A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families)

5. Family b.18.1.19: Family 29 carbohydrate binding module, CBM29 [89244] (2 proteins)

6. Protein automated matches [190801] (1 species)
   not a true protein

7. Species Piromyces equi [TaxId:99929] [188067] (6 PDB entries)

8. Domain d1w8ua_: 1w8u A: [161920]
   automated match to d1gwma_
   mutant

Details for d1w8ua_

PDB Entry: 1w8u, 1.3 Å

PDB Description: cbm29-2 mutant d83a complexed with mannohexaose: probing the mechanism of ligand recognition by family 29 carbohydrate binding modules

PDB Compounds: (A:) non catalytic protein 1

SCOPe Domain Sequences for d1w8ua_:

Sequence; same for both SEQRES and ATOM records:

>d1w8ua_ b.18.1.19 (A:) automated matches {Piromyces equi [TaxId: 99929]}
vratytvifknasglpngydnwgwgctlsyyggamiinpqegkygavslkrnsgsfrggs
lrfdmknegkvkilvenseaaekfevetispsdeyvtyildvdfdlpfdridfqdapgng
driwiknlvhstgsaddfvdp

Timeline for d1w8ua_:

• d1w8ua_ is new in SCOPe 2.01-stable
  
• d1w8ua_ appears in SCOPe 2.02
  
• d1w8ua_ appears in the current release, SCOPe 2.08