Lineage for d1w8ua_ (1w8u A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774792Family b.18.1.19: Family 29 carbohydrate binding module, CBM29 [89244] (2 proteins)
  6. 2774801Protein automated matches [190801] (1 species)
    not a true protein
  7. 2774802Species Piromyces equi [TaxId:99929] [188067] (6 PDB entries)
  8. 2774803Domain d1w8ua_: 1w8u A: [161920]
    automated match to d1gwma_
    mutant

Details for d1w8ua_

PDB Entry: 1w8u (more details), 1.3 Å

PDB Description: cbm29-2 mutant d83a complexed with mannohexaose: probing the mechanism of ligand recognition by family 29 carbohydrate binding modules
PDB Compounds: (A:) non catalytic protein 1

SCOPe Domain Sequences for d1w8ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w8ua_ b.18.1.19 (A:) automated matches {Piromyces equi [TaxId: 99929]}
vratytvifknasglpngydnwgwgctlsyyggamiinpqegkygavslkrnsgsfrggs
lrfdmknegkvkilvenseaaekfevetispsdeyvtyildvdfdlpfdridfqdapgng
driwiknlvhstgsaddfvdp

SCOPe Domain Coordinates for d1w8ua_:

Click to download the PDB-style file with coordinates for d1w8ua_.
(The format of our PDB-style files is described here.)

Timeline for d1w8ua_: