Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) |
Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) |
Protein automated matches [190406] (14 species) not a true protein |
Species Jellyfish (Aequorea victoria) [TaxId:6100] [188134] (27 PDB entries) |
Domain d1w7ta_: 1w7t A: [161911] automated match to d1hcjc_ |
PDB Entry: 1w7t (more details), 1.85 Å
SCOPe Domain Sequences for d1w7ta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w7ta_ d.22.1.1 (A:) automated matches {Jellyfish (Aequorea victoria) [TaxId: 6100]} skgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlv ttfsygvqcfsrypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlvn rielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladh yqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagith
Timeline for d1w7ta_: