SCOPe 2.01: Domain d1w6xb_: 1w6x B:

Lineage for d1w6xb_ (1w6x B:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.0: automated matches [191375] (1 protein)
   not a true family

6. Protein automated matches [190457] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187598] (8 PDB entries)

8. Domain d1w6xb_: 1w6x B: [161906]
   automated match to d1k4us_

Details for d1w6xb_

PDB Entry: 1w6x, 2 Å

PDB Description: sh3 domain of p40phox, component of the nadph oxidase

PDB Compounds: (B:) neutrophil cytosol factor 4

SCOPe Domain Sequences for d1w6xb_:

Sequence; same for both SEQRES and ATOM records:

>d1w6xb_ b.34.2.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mraealfdftgnsklelnfkagdvifllsrinkdwlegtvrgatgifplsfvkilk

Timeline for d1w6xb_:

• d1w6xb_ is new in SCOPe 2.01-stable
  
• d1w6xb_ appears in SCOPe 2.02
  
• d1w6xb_ appears in the current release, SCOPe 2.08, called d1w6xb1