Lineage for d1w6xa_ (1w6x A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2053585Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2053714Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2054180Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 2054181Protein automated matches [190457] (10 species)
    not a true protein
  7. 2054253Species Human (Homo sapiens) [TaxId:9606] [187598] (90 PDB entries)
  8. 2054285Domain d1w6xa_: 1w6x A: [161905]
    automated match to d1k4us_

Details for d1w6xa_

PDB Entry: 1w6x (more details), 2 Å

PDB Description: sh3 domain of p40phox, component of the nadph oxidase
PDB Compounds: (A:) neutrophil cytosol factor 4

SCOPe Domain Sequences for d1w6xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w6xa_ b.34.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mraealfdftgnsklelnfkagdvifllsrinkdwlegtvrgatgifplsfvkilk

SCOPe Domain Coordinates for d1w6xa_:

Click to download the PDB-style file with coordinates for d1w6xa_.
(The format of our PDB-style files is described here.)

Timeline for d1w6xa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1w6xb_