Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.3: 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51594] (2 proteins) hybrid of classes I and II aldolase automatically mapped to Pfam PF00490 |
Protein automated matches [190088] (5 species) not a true protein |
Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [188066] (6 PDB entries) |
Domain d1w5ob_: 1w5o B: [161900] automated match to d1gzgb_ complexed with gol, k, mg, zn; mutant |
PDB Entry: 1w5o (more details), 1.85 Å
SCOPe Domain Sequences for d1w5ob_:
Sequence, based on SEQRES records: (download)
>d1w5ob_ c.1.10.3 (B:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]} nraypytrlrrnrrddfsrrlvrenvltvddlilpvfvldgvnqresipsmpgverlsid qllieaeewvalgipalalfpvtpvekksldaaeaynpegiaqratralrerfpelgiit dvclcpftthgqcgildddgyvlndvsidvlvrqalshaeagaqvvapsdmmdgrigair ealesaghtnvrvmaysakyasayygpfrdavgsasnlgkgnkatyqmdpansdealhev aadlaegadmvmvkpgmpyldivrrvkdefraptfvyqvsgeyamhmgaiqngwlaesvi lesltafkragadgiltyfakqaaeqlrrg
>d1w5ob_ c.1.10.3 (B:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]} nraypytrlrrnrrddfsrrlvrenvltvddlilpvfvldgvnqresipsmpgverlsid qllieaeewvalgipalalfpvtpvekksldaaeaynpegiaqratralrerfpelgiit dvclcpftthgqcgildddgyvlndvsidvlvrqalshaeagaqvvapsdmmdgrigair ealesaghtnvrvmaysakyasayygpfrdavgsnkatyqmdpansdealhevaadlaeg admvmvkpgmpyldivrrvkdefraptfvyqvsgeyamhmgaiqngwlaesvilesltaf kragadgiltyfakqaaeqlrrg
Timeline for d1w5ob_: