SCOPe 2.08: Domain d2irfl_: 2irf L:

Lineage for d2irfl_ (2irf L:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.23: Interferon regulatory factor [46877] (4 proteins)
   Pfam PF00605

6. Protein Interferon regulatory factor-2, IRF-2 [46880] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [46881] (3 PDB entries)

8. Domain d2irfl_: 2irf L: [16190]
   protein/DNA complex; complexed with k

Details for d2irfl_

PDB Entry: 2irf, 2.2 Å

PDB Description: crystal structure of an irf-2/dna complex.

PDB Compounds: (L:) interferon regulatory factor 2

SCOPe Domain Sequences for d2irfl_:

Sequence; same for both SEQRES and ATOM records:

>d2irfl_ a.4.5.23 (L:) Interferon regulatory factor-2, IRF-2 {Mouse (Mus musculus) [TaxId: 10090]}
rmrmrpwleeqinsntipglkwlnkekkifqipwmhaarhgwdvekdaplfrnwaihtgk
hqpgidkpdpktwkanfrcamnslpdieevkdrsikkgnnafrvyrmlp

Timeline for d2irfl_:

• d2irfl_ first appeared (with stable ids) in SCOP 1.55
  
• d2irfl_ appears in SCOPe 2.07