![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.10: Aldolase [51569] (9 families) ![]() Common fold covers whole protein structure |
![]() | Family c.1.10.3: 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51594] (2 proteins) hybrid of classes I and II aldolase automatically mapped to Pfam PF00490 |
![]() | Protein automated matches [190088] (5 species) not a true protein |
![]() | Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [188066] (6 PDB entries) |
![]() | Domain d1w5ma_: 1w5m A: [161895] automated match to d1gzgb_ complexed with cl, fmt, mg, zn; mutant |
PDB Entry: 1w5m (more details), 1.6 Å
SCOPe Domain Sequences for d1w5ma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w5ma_ c.1.10.3 (A:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]} nraypytrlrrnrrddfsrrlvrenvltvddlilpvfvldgvnqresipsmpgverlsid qllieaeewvalgipalalfpvtpvekksldaaeaynpegiaqratralrerfpelgiit dvcldpftthgqcgildddgyvlndvsidvlvrqalshaeagaqvvapsdmmdgrigair ealesaghtnvrvmaysakyasayygpfrdavgsasnlgkgnkatyqmdpansdealhev aadlaegadmvmvkpgmpyldivrrvkdefraptfvyqvsgeyamhmgaiqngwlaesvi lesltafkragadgiltyfakqaaeqlrrg
Timeline for d1w5ma_: