Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.3: 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51594] (2 proteins) hybrid of classes I and II aldolase automatically mapped to Pfam PF00490 |
Protein automated matches [190088] (3 species) not a true protein |
Species Pseudomonas aeruginosa [TaxId:208964] [188066] (6 PDB entries) |
Domain d1w56b_: 1w56 B: [161894] automated match to d1gzgb_ complexed with fmt, k, mg, zn; mutant |
PDB Entry: 1w56 (more details), 1.7 Å
SCOPe Domain Sequences for d1w56b_:
Sequence, based on SEQRES records: (download)
>d1w56b_ c.1.10.3 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]} anraypytrlrrnrrddfsrrlvrenvltvddlilpvfvldgvnqresipsmpgverlsi dqllieaeewvalgipalalfpvtpvekksldaaeaynpegiaqratralrerfpelgii tdvclcpftthgqdgildddgyvlndvsidvlvrqalshaeagaqvvapsdmmdgrigai realesaghtnvrvmaysakyasayygpfrdavgsasnlgkgnkatyqmdpansdealhe vaadlaegadmvmvkpgmpyldivrrvkdefraptfvyqvsgeyamhmgaiqngwlaesv ilesltafkragadgiltyfakqaaeqlrrg
>d1w56b_ c.1.10.3 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]} anraypytrlrrnrrddfsrrlvrenvltvddlilpvfvldgvnqresipsmpgverlsi dqllieaeewvalgipalalfpvtpvekksldaaeaynpegiaqratralrerfpelgii tdvclcpftthgqdgildddgyvlndvsidvlvrqalshaeagaqvvapsdmmdgrigai realesaghtnvrvmaysakyasayygpfrdavgsnkatyqmdpansdealhevaadlae gadmvmvkpgmpyldivrrvkdefraptfvyqvsgeyamhmgaiqngwlaesvileslta fkragadgiltyfakqaaeqlrrg
Timeline for d1w56b_: