Lineage for d1w56a_ (1w56 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2835458Family c.1.10.3: 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51594] (2 proteins)
    hybrid of classes I and II aldolase
    automatically mapped to Pfam PF00490
  6. 2835500Protein automated matches [190088] (4 species)
    not a true protein
  7. 2835521Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [188066] (6 PDB entries)
  8. 2835530Domain d1w56a_: 1w56 A: [161893]
    automated match to d1gzgb_
    complexed with fmt, k, mg, zn; mutant

Details for d1w56a_

PDB Entry: 1w56 (more details), 1.7 Å

PDB Description: stepwise introduction of zinc binding site into porphobilinogen synthase of pseudomonas aeruginosa (mutations a129c and d131c)
PDB Compounds: (A:) delta-aminolevulinic acid dehydratase

SCOPe Domain Sequences for d1w56a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w56a_ c.1.10.3 (A:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
nraypytrlrrnrrddfsrrlvrenvltvddlilpvfvldgvnqresipsmpgverlsid
qllieaeewvalgipalalfpvtpvekksldaaeaynpegiaqratralrerfpelgiit
dvclcpftthgqdgildddgyvlndvsidvlvrqalshaeagaqvvapsdmmdgrigair
ealesaghtnvrvmaysakyasayygpfrdavgsasnlgkgnkatyqmdpansdealhev
aadlaegadmvmvkpgmpyldivrrvkdefraptfvyqvsgeyamhmgaiqngwlaesvi
lesltafkragadgiltyfakqaaeqlrrg

SCOPe Domain Coordinates for d1w56a_:

Click to download the PDB-style file with coordinates for d1w56a_.
(The format of our PDB-style files is described here.)

Timeline for d1w56a_: