SCOPe 2.08: Domain d1w56a_: 1w56 A:

Lineage for d1w56a_ (1w56 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.3: 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51594] (2 proteins)
   hybrid of classes I and II aldolase
   automatically mapped to Pfam PF00490

6. Protein automated matches [190088] (4 species)
   not a true protein

7. Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [188066] (6 PDB entries)

8. Domain d1w56a_: 1w56 A: [161893]
   automated match to d1gzgb_
   complexed with fmt, k, mg, zn; mutant

Details for d1w56a_

PDB Entry: 1w56, 1.7 Å

PDB Description: stepwise introduction of zinc binding site into porphobilinogen synthase of pseudomonas aeruginosa (mutations a129c and d131c)

PDB Compounds: (A:) delta-aminolevulinic acid dehydratase

SCOPe Domain Sequences for d1w56a_:

Sequence; same for both SEQRES and ATOM records:

>d1w56a_ c.1.10.3 (A:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
nraypytrlrrnrrddfsrrlvrenvltvddlilpvfvldgvnqresipsmpgverlsid
qllieaeewvalgipalalfpvtpvekksldaaeaynpegiaqratralrerfpelgiit
dvclcpftthgqdgildddgyvlndvsidvlvrqalshaeagaqvvapsdmmdgrigair
ealesaghtnvrvmaysakyasayygpfrdavgsasnlgkgnkatyqmdpansdealhev
aadlaegadmvmvkpgmpyldivrrvkdefraptfvyqvsgeyamhmgaiqngwlaesvi
lesltafkragadgiltyfakqaaeqlrrg

Timeline for d1w56a_:

• d1w56a_ first appeared in SCOPe 2.01
  
• d1w56a_ appears in SCOPe 2.07