Lineage for d1w3wa_ (1w3w A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717085Fold a.65: Annexin [47873] (1 superfamily)
    5 helices; folded leaf, closed
  4. 2717086Superfamily a.65.1: Annexin [47874] (2 families) (S)
    duplication: consists of four domains of the same fold
  5. 2717205Family a.65.1.0: automated matches [191494] (1 protein)
    not a true family
  6. 2717206Protein automated matches [190800] (2 species)
    not a true protein
  7. 2717207Species Human (Homo sapiens) [TaxId:9606] [188064] (6 PDB entries)
  8. 2717209Domain d1w3wa_: 1w3w A: [161888]
    automated match to d1anna_
    complexed with ca

Details for d1w3wa_

PDB Entry: 1w3w (more details), 1.99 Å

PDB Description: the 2.1 angstroem resolution structure of annexin a8
PDB Compounds: (A:) annexin a8

SCOPe Domain Sequences for d1w3wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w3wa_ a.65.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ssshfnpdpdaetlykamkgigtneqaiidvltkrsntqrqqiaksfkaqfgkdltetlk
selsgkferlivalmyppyryeakelhdamkglgtkegviieilasrtknqlreimkaye
edygssleediqadtsgylerilvcllqgsrddvssfvdpalalqdaqdlyaagekirgt
demkfitilctrsathllrvfeeyekianksiedsiksethgsleeamltvvkctqnlhs
yfaerlyyamkgagtrdgtlirnivsrseidlnlikchfkkmygktlssmimedtsgdyk
nallslvgsdp

SCOPe Domain Coordinates for d1w3wa_:

Click to download the PDB-style file with coordinates for d1w3wa_.
(The format of our PDB-style files is described here.)

Timeline for d1w3wa_: