Lineage for d1w21d_ (1w21 D:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 959648Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 959649Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 959650Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins)
  6. 959827Protein automated matches [190279] (4 species)
    not a true protein
  7. 959843Species Influenza A virus [TaxId:11320] [187447] (5 PDB entries)
  8. 959859Domain d1w21d_: 1w21 D: [161887]
    automated match to d5nn9a_
    complexed with bma, ca, gol, man, nag, sia

Details for d1w21d_

PDB Entry: 1w21 (more details), 2.08 Å

PDB Description: structure of neuraminidase from english duck subtype n6 complexed with 30 mm sialic acid (nana, neu5ac), crystal soaked for 43 hours at 291 k.
PDB Compounds: (D:) Neuraminidase

SCOPe Domain Sequences for d1w21d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w21d_ b.68.1.1 (D:) automated matches {Influenza A virus [TaxId: 11320]}
rtflnltkplcevnswhilskdnairigedahilvtrepylscdpqgcrmfalsqgttlr
grhangtihdrspfraliswemgqapspyntrvecigwsstschdgmsrmsicmsgpnnn
asavvwyggrpiteipswagnilrtqesecvchkgvcpvvmtdgpannraatkiiyfkeg
kiqkieelagnaqhieecscygaggvikcicrdnwkganrpvitidpemmthtskylcsk
vltdtsrpndptngncdapitggspdpgvkgfafldgenswlgrtiskdsrsgyemlkvp
naetdiqsgpisnqvivnnqnwsgysgafidywankecfnpcfyvelirgrpkessvlwt
snsivalcgskkrlgswswhdgaeiiyfe

SCOPe Domain Coordinates for d1w21d_:

Click to download the PDB-style file with coordinates for d1w21d_.
(The format of our PDB-style files is described here.)

Timeline for d1w21d_: