Class b: All beta proteins [48724] (177 folds) |
Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies) consists of six 4-stranded beta-sheet motifs; meander |
Superfamily b.68.1: Sialidases [50939] (3 families) |
Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins) |
Protein Influenza neuraminidase [50943] (4 species) |
Species Influenza A virus, different strains [TaxId:11320] [50944] (78 PDB entries) Uniprot P03472 84-470 |
Domain d1w1xd_: 1w1x D: [161879] automated match to d5nn9a_ complexed with bma, ca, gol, man, nag, peg, sia |
PDB Entry: 1w1x (more details), 2 Å
SCOPe Domain Sequences for d1w1xd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w1xd_ b.68.1.1 (D:) Influenza neuraminidase {Influenza A virus, different strains [TaxId: 11320]} rtflnltkplcevnswhilskdnairigedahilvtrepylscdpqgcrmfalsqgttlr grhangtihdrspfraliswemgqapspyntrvecigwsstschdgmsrmsicmsgpnnn asavvwyggrpiteipswagnilrtqesecvchkgvcpvvmtdgpannraatkiiyfkeg kiqkieelagnaqhieecscygaggvikcicrdnwkganrpvitidpemmthtskylcsk vltdtsrpndptngncdapitggspdpgvkgfafldgenswlgrtiskdsrsgyemlkvp naetdiqsgpisnqvivnnqnwsgysgafidywankecfnpcfyvelirgrpkessvlwt snsivalcgskkrlgswswhdgaeiiyfe
Timeline for d1w1xd_: