Lineage for d1vzma_ (1vzm A:)

  1. Root: SCOPe 2.08
  2. Class g: Small proteins [56992] (100 folds)
  3. Fold g.32: GLA-domain [57629] (1 superfamily)
    Calcium ion-bound
  4. Superfamily g.32.1: GLA-domain [57630] (2 families) (S)
    gamma-carboxy-glutamic acid-rich domain
  5. Family g.32.1.0: automated matches [191493] (1 protein)
    not a true family
  6. Protein automated matches [190799] (2 species)
    not a true protein
  7. Species Argyrosomus regius [TaxId:172269] [188062] (1 PDB entry)
  8. Domain d1vzma_: 1vzm A: [161873]
    automated match to d1q3ma_
    complexed with mg

Details for d1vzma_

PDB Entry: 1vzm (more details), 1.4 Å

PDB Description: osteocalcin from fish argyrosomus regius
PDB Compounds: (A:) Osteocalcin

SCOPe Domain Sequences for d1vzma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vzma_ g.32.1.0 (A:) automated matches {Argyrosomus regius [TaxId: 172269]}
keltlaqteslrevcetnmacdemadaqgivaayqafygpipf

SCOPe Domain Coordinates for d1vzma_ are not available.

Timeline for d1vzma_:

Domains from other chains:
(mouse over for more information)
d1vzmb_, d1vzmc_