SCOPe 2.02: Domain d1vyob_: 1vyo B:

Lineage for d1vyob_ (1vyo B:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein automated matches [190191] (2 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [186931] (19 PDB entries)

8. Domain d1vyob_: 1vyo B: [161872]
   automated match to d1rava_
   complexed with gol

Details for d1vyob_

PDB Entry: 1vyo, 1.48 Å

PDB Description: crystal structure of avidin

PDB Compounds: (B:) Avidin

SCOPe Domain Sequences for d1vyob_:

Sequence; same for both SEQRES and ATOM records:

>d1vyob_ b.61.1.1 (B:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
rkcsltgkwtndlgsnmtigavnsrgeftgtyitavtatsneikesplhgtqntinkrtq
ptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginift
rl

Timeline for d1vyob_:

• d1vyob_ first appeared in SCOPe 2.01
  
• d1vyob_ appears in SCOPe 2.03
  
• d1vyob_ appears in the current release, SCOPe 2.08