SCOPe 2.07: Domain d1vyoa_: 1vyo A:

Lineage for d1vyoa_ (1vyo A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein automated matches [190191] (2 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [186931] (28 PDB entries)

8. Domain d1vyoa_: 1vyo A: [161871]
   automated match to d1rava_
   complexed with gol

Details for d1vyoa_

PDB Entry: 1vyo, 1.48 Å

PDB Description: crystal structure of avidin

PDB Compounds: (A:) Avidin

SCOPe Domain Sequences for d1vyoa_:

Sequence; same for both SEQRES and ATOM records:

>d1vyoa_ b.61.1.1 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
kcsltgkwtndlgsnmtigavnsrgeftgtyitavtatsneikesplhgtqntinkrtqp
tfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftr
l

Timeline for d1vyoa_:

• d1vyoa_ first appeared in SCOPe 2.01
  
• d1vyoa_ appears in SCOPe 2.06
  
• d1vyoa_ appears in the current release, SCOPe 2.08