Lineage for d2irfi_ (2irf I:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693544Family a.4.5.23: Interferon regulatory factor [46877] (4 proteins)
    Pfam PF00605
  6. 2693561Protein Interferon regulatory factor-2, IRF-2 [46880] (1 species)
  7. 2693562Species Mouse (Mus musculus) [TaxId:10090] [46881] (3 PDB entries)
  8. 2693565Domain d2irfi_: 2irf I: [16187]
    protein/DNA complex; complexed with k

Details for d2irfi_

PDB Entry: 2irf (more details), 2.2 Å

PDB Description: crystal structure of an irf-2/dna complex.
PDB Compounds: (I:) interferon regulatory factor 2

SCOPe Domain Sequences for d2irfi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2irfi_ a.4.5.23 (I:) Interferon regulatory factor-2, IRF-2 {Mouse (Mus musculus) [TaxId: 10090]}
rmrmrpwleeqinsntipglkwlnkekkifqipwmhaarhgwdvekdaplfrnwaihtgk
hqpgidkpdpktwkanfrcamnslpdieevkdrsikkgnnafrvyrmlp

SCOPe Domain Coordinates for d2irfi_:

Click to download the PDB-style file with coordinates for d2irfi_.
(The format of our PDB-style files is described here.)

Timeline for d2irfi_: