Lineage for d1vgpa_ (1vgp A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 921025Fold a.103: Citrate synthase [48255] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 921026Superfamily a.103.1: Citrate synthase [48256] (2 families) (S)
  5. 921112Family a.103.1.0: automated matches [191476] (1 protein)
    not a true family
  6. 921113Protein automated matches [190763] (3 species)
    not a true protein
  7. 921117Species Sulfolobus tokodaii [TaxId:111955] [188057] (1 PDB entry)
  8. 921118Domain d1vgpa_: 1vgp A: [161865]
    automated match to d1aj8a_

Details for d1vgpa_

PDB Entry: 1vgp (more details), 2.7 Å

PDB Description: crystal structure of an isozyme of citrate synthase from sulfolbus tokodaii strain7
PDB Compounds: (A:) 373aa long hypothetical citrate synthase

SCOPe Domain Sequences for d1vgpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vgpa_ a.103.1.0 (A:) automated matches {Sulfolobus tokodaii [TaxId: 111955]}
meikkgledvyvketeityidgelgrlyyrgysiydlaefsnfeevsylilygklpnree
lnwfqeklreerylpdfiikflrevrkdaqpmdilrtavsllgiedskndertdikgikl
iskfptivanyarlrkgldiiepdpklshsenflymlygdrpneikskamdvtlilhidh
emnastfaslvvastfsdlyssivagisalkgplhgganyealkmfkeigspekvndyil
nrlsnkqrimgfghrvyktydprarilkqyakllaekeggeiytlyqiaekveeigikyl
gpkgiypnvdffssivfyslgfepdffpavfasarvvgwvahimeyikdnkiirpkayyk
geigkkyipidsr

SCOPe Domain Coordinates for d1vgpa_:

Click to download the PDB-style file with coordinates for d1vgpa_.
(The format of our PDB-style files is described here.)

Timeline for d1vgpa_: