SCOPe 2.05: Domain d1vgld_: 1vgl D:

Lineage for d1vgld_ (1vgl D:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.15: KaiB-like [102449] (3 proteins)
   Pfam PF07689; contains members with alternative folds

6. Protein automated matches [190797] (3 species)
   not a true protein

7. Species Thermosynechococcus elongatus [TaxId:197221] [188059] (1 PDB entry)

8. Domain d1vgld_: 1vgl D: [161860]
   automated match to d1r5pb_
   complexed with hg

Details for d1vgld_

PDB Entry: 1vgl, 2.6 Å

PDB Description: crystal structure of tetrameric kaib from t.elongatus bp-1

PDB Compounds: (D:) Circadian clock protein kaiB

SCOPe Domain Sequences for d1vgld_:

Sequence; same for both SEQRES and ATOM records:

>d1vgld_ c.47.1.15 (D:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
rktyvlklyvagntpnsvralktlnnilekefkgvyalkvidvlknpqlaeedkilatpc
lakvlpppvrriigdlsnrekvligldllyeeigdqaeddlgl

Timeline for d1vgld_:

• d1vgld_ first appeared in SCOPe 2.01
  
• d1vgld_ appears in SCOPe 2.04
  
• d1vgld_ appears in SCOPe 2.06
  
• d1vgld_ appears in the current release, SCOPe 2.08