Lineage for d1vgld_ (1vgl D:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. Family c.47.1.15: KaiB-like [102449] (3 proteins)
    Pfam PF07689; contains members with alternative folds
  6. Protein automated matches [190797] (3 species)
    not a true protein
  7. Species Thermosynechococcus elongatus [TaxId:197221] [188059] (5 PDB entries)
  8. Domain d1vgld_: 1vgl D: [161860]
    automated match to d1r5pb_
    complexed with hg

Details for d1vgld_

PDB Entry: 1vgl (more details), 2.6 Å

PDB Description: Crystal structure of tetrameric KaiB from T.elongatus BP-1
PDB Compounds: (D:) Circadian clock protein kaiB

SCOPe Domain Sequences for d1vgld_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vgld_ c.47.1.15 (D:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
rktyvlklyvagntpnsvralktlnnilekefkgvyalkvidvlknpqlaeedkilatpc
lakvlpppvrriigdlsnrekvligldllyeeigdqaeddlgl

SCOPe Domain Coordinates for d1vgld_ are not available.

Timeline for d1vgld_:

Domains from other chains:
(mouse over for more information)
d1vgla_, d1vglb_, d1vglc_