| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.23: Interferon regulatory factor [46877] (4 proteins) Pfam PF00605 |
| Protein Interferon regulatory factor-2, IRF-2 [46880] (1 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [46881] (3 PDB entries) |
| Domain d2irfh_: 2irf H: [16186] protein/DNA complex; complexed with k |
PDB Entry: 2irf (more details), 2.2 Å
SCOPe Domain Sequences for d2irfh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2irfh_ a.4.5.23 (H:) Interferon regulatory factor-2, IRF-2 {Mouse (Mus musculus) [TaxId: 10090]}
rmrmrpwleeqinsntipglkwlnkekkifqipwmhaarhgwdvekdaplfrnwaihtgk
hqpgidkpdpktwkanfrcamnslpdieevkdrsikkgnnafrvyrmlp
Timeline for d2irfh_: