| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.15: KaiB-like [102449] (3 proteins) Pfam PF07689; contains members with alternative folds |
| Protein automated matches [190797] (3 species) not a true protein |
| Species Thermosynechococcus elongatus [TaxId:197221] [188059] (5 PDB entries) |
| Domain d1vglb_: 1vgl B: [161858] automated match to d1r5pb_ complexed with hg |
PDB Entry: 1vgl (more details), 2.6 Å
SCOPe Domain Sequences for d1vglb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vglb_ c.47.1.15 (B:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
lrktyvlklyvagntpnsvralktlnnilekefkgvyalkvidvlknpqlaeedkilatp
clakvlpppvrriigdlsnrekvligldllyeeigdqaeddlgle
Timeline for d1vglb_: