Lineage for d1vezb_ (1vez B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2558557Fold d.167: Peptide deformylase [56419] (1 superfamily)
    alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix
  4. 2558558Superfamily d.167.1: Peptide deformylase [56420] (2 families) (S)
    nickel-dependent enzyme
  5. 2558559Family d.167.1.1: Peptide deformylase [56421] (2 proteins)
    automatically mapped to Pfam PF01327
  6. 2558560Protein Peptide deformylase [56422] (11 species)
  7. 2558612Species Leptospira interrogans [TaxId:173] [103340] (5 PDB entries)
    Uniprot Q72S74
  8. 2558618Domain d1vezb_: 1vez B: [161855]
    automated match to d1y6ha_
    complexed with fmt, trs, zn

Details for d1vezb_

PDB Entry: 1vez (more details), 2.3 Å

PDB Description: Crystal Structure of Peptide Deformylase from Leptospira Interrogans(LiPDF) at pH8.0
PDB Compounds: (B:) Peptide deformylase

SCOPe Domain Sequences for d1vezb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vezb_ d.167.1.1 (B:) Peptide deformylase {Leptospira interrogans [TaxId: 173]}
svrkilrmgdpilrkisepvtedeiqtkefkklirdmfdtmrhaegvglaapqigilkqi
vvvgsednerypgtpdvperiilnpvitpltkdtsgfwegclsvpgmrgyverpnqirmq
wmdekgnqfdetidgykaivyqhecdhlqgilyvdrlkdtklfgfnetlds

SCOPe Domain Coordinates for d1vezb_:

Click to download the PDB-style file with coordinates for d1vezb_.
(The format of our PDB-style files is described here.)

Timeline for d1vezb_: