Lineage for d1ve0a_ (1ve0 A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.273: YjbQ-like [111037] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha(2)-beta(3); contains a beta-sandwich: 7 strands in 2 sheets; trimerizes with orthogonally packed beta-sheets
  4. Superfamily d.273.1: YjbQ-like [111038] (2 families) (S)
  5. Family d.273.1.0: automated matches [191413] (1 protein)
    not a true family
  6. Protein automated matches [190572] (3 species)
    not a true protein
  7. Species Sulfolobus tokodaii [TaxId:111955] [188056] (1 PDB entry)
  8. Domain d1ve0a_: 1ve0 A: [161851]
    automated match to d1vphb_
    complexed with so4, zn

Details for d1ve0a_

PDB Entry: 1ve0 (more details), 2 Å

PDB Description: Crystal structure of uncharacterized protein ST2072 from Sulfolobus tokodaii
PDB Compounds: (A:) hypothetical protein (ST2072)

SCOPe Domain Sequences for d1ve0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ve0a_ d.273.1.0 (A:) automated matches {Sulfolobus tokodaii [TaxId: 111955]}
mkiiskeftvktrsrfdsiditeqvseaikginngiahvivkhttcaiiineaesglmkd
flnwakklvppdgefehniidnnghahvisaiignsrvvpiiegkldlgtwqriillefd
gprtrtvlvksmge

SCOPe Domain Coordinates for d1ve0a_ are not available.

Timeline for d1ve0a_: