Lineage for d2irfg_ (2irf G:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693544Family a.4.5.23: Interferon regulatory factor [46877] (4 proteins)
    Pfam PF00605
  6. 2693561Protein Interferon regulatory factor-2, IRF-2 [46880] (1 species)
  7. 2693562Species Mouse (Mus musculus) [TaxId:10090] [46881] (3 PDB entries)
  8. 2693563Domain d2irfg_: 2irf G: [16185]
    protein/DNA complex; complexed with k

Details for d2irfg_

PDB Entry: 2irf (more details), 2.2 Å

PDB Description: crystal structure of an irf-2/dna complex.
PDB Compounds: (G:) interferon regulatory factor 2

SCOPe Domain Sequences for d2irfg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2irfg_ a.4.5.23 (G:) Interferon regulatory factor-2, IRF-2 {Mouse (Mus musculus) [TaxId: 10090]}
rmrmrpwleeqinsntipglkwlnkekkifqipwmhaarhgwdvekdaplfrnwaihtgk
hqpgidkpdpktwkanfrcamnslpdieevkdrsikkgnnafrvyrmlp

SCOPe Domain Coordinates for d2irfg_:

Click to download the PDB-style file with coordinates for d2irfg_.
(The format of our PDB-style files is described here.)

Timeline for d2irfg_: