SCOPe 2.07: Domain d1vd3a_: 1vd3 A:

Lineage for d1vd3a_ (1vd3 A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.124: Ribonuclease Rh-like [55894] (1 superfamily)
   alpha+beta fold

4. Superfamily d.124.1: Ribonuclease Rh-like [55895] (2 families)

5. Family d.124.1.1: Ribonuclease Rh-like [55896] (9 proteins)

6. Protein automated matches [190794] (1 species)
   not a true protein

7. Species Nicotiana glutinosa [TaxId:35889] [188052] (3 PDB entries)

8. Domain d1vd3a_: 1vd3 A: [161849]
   automated match to d1iyba_
   protein/RNA complex; complexed with u2p

Details for d1vd3a_

PDB Entry: 1vd3, 1.8 Å

PDB Description: Ribonuclease NT in complex with 2'-UMP

PDB Compounds: (A:) RNase NGR3

SCOPe Domain Sequences for d1vd3a_:

Sequence; same for both SEQRES and ATOM records:

>d1vd3a_ d.124.1.1 (A:) automated matches {Nicotiana glutinosa [TaxId: 35889]}
aqdfdffyfvqqwpasycdtrrsccypttgkpdedfsihglwpnyengkwpqncdressl
deseisdlistmeknwpslacpssdgvrfwshewlkhgtcsalgerayfqaaldfrkksn
llenlknaeitprngehytlesikkaieegvghspyiecnvdtqgnhqiyqvylcvdkta
tdfidcpifphgrgcgskiefppf

Timeline for d1vd3a_:

• d1vd3a_ first appeared in SCOPe 2.01
  
• d1vd3a_ appears in SCOPe 2.06
  
• d1vd3a_ appears in the current release, SCOPe 2.08